PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang11g18130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family ZF-HD
Protein Properties Length: 180aa    MW: 20045.9 Da    PI: 9.0376
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang11g18130.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer84.21.4e-261481058
     ZF-HD_dimer 10 lkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
                    lkNhAa++Gg+a+DGCgEfmps geegt++al+C+AC CHRnFHR+eve
  Vang11g18130.1  1 LKNHAAAMGGNATDGCGEFMPS-GEEGTIEALNCSACHCHRNFHRKEVE 48
                    69*******************9.999********************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-21149IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152323.71146IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015667.0E-27147IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047709.7E-24147IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.603.7E-3199172IPR009057Homeodomain-like
SuperFamilySSF466896.34E-20103171IPR009057Homeodomain-like
TIGRFAMsTIGR015658.1E-28110166IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
LKNHAAAMGG NATDGCGEFM PSGEEGTIEA LNCSACHCHR NFHRKEVEGP HKNLLPPEAL  60
GYPTGNILPS RSVPPHQMIM PYSIGHLPSE SDEQEDGGGM VQPRPSQLVK KRFRTKFTQE  120
QKEKMLNFAE RVGWKIQKQE ESVVQQFCQE IGVKRRVLKV WMHNNKHNLA KKNPPTAAA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh5_A3e-251091681675ZF-HD homeobox family protein
1wh7_A3e-251111681875ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007154109.11e-128hypothetical protein PHAVU_003G091100g
SwissprotO647222e-70ZHD3_ARATH; Zinc-finger homeodomain protein 3
TrEMBLV7C9S31e-128V7C9S3_PHAVU; Uncharacterized protein
STRINGVIT_12s0035g01880.t011e-102(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02540.11e-71homeobox protein 21